Shop Our Top Picks

New ArrivalsTop Deals
Today's Moment

Shop by Category

Shop All Categories

Accessories

Baby & Kids

Clothing & Shoes

Crafts & Party Supplies

Electronics

Home Décor

Invitations & Stationery

Office & School

Sports, Toys & Games

Wall Art & Décor

Weddings

Create Your Own

Shop All Products

Officially Licensed Brands

Customizable Designs From Brands You Love

Find the Perfect Gift

More Ways to Save

Shop the Sale

Personalized Purple Lilacs Mirror For Makeup (Side)Personalized Purple Lilacs Mirror For Makeup (Turned)Personalized Purple Lilacs Mirror For Makeup (Opened)
Personalized Purple Lilacs Mirror For Makeup (Front)

Personalized Purple Lilacs Mirror For Makeup

4.8(364)
$19.50 Comp. value
i
$16.58
per compact mirror
Save 15% with code FRESHFINDS4U
View Product Details

Other designs from this category

About Compact Mirror

Sold by

Shape: Oval Compact Mirror

Customize a compact mirror for stylish touch-ups on the go! Available in four fun shapes, this luxurious compact mirror is a one-of-a-kind accessory that fits perfectly in your purse.

  • Dimensions: 2.3"l x 2.8"w x 0.4"h
  • Design printed in vibrant color on metal insert on front of compact mirror
  • All-metal contruction, inside mirrors on both sides
This product is recommended for ages 13+.

About This Design

Personalized Purple Lilacs Mirror For Makeup

Lilac flowers in beautiful shades of lavender, purple and periwinkle. An elegant damask motif embellishes the left side. The background is a soft lavender. Personalize this compact mirror with a name or monogram. They great to hand out as bridal wedding party favors or gifts.

Reviews

 5.0 (1)
4 star:  
 0%
3 star:  
 0%
2 star:  
 0%
1 star:  
 0%
  • "Perfect Gift for Co-Worker"
    Member
    Reviewed by Carol Ann Doner
    December 22, 2017
    Personalized Purple Lilacs
    Product Quality
    Excellent
    Print Quality
    Excellent
    Recommended
    Yes
    Recommended For
    Any kind of gift, this was for Christmas
    Shipped on Time
    Yes
    About the Product
    This compact, personalized with my co-worker's name made her happy. It is perfect for those people who you have a spending limit, but want something special.
    About the Print
    Very nice. The font is lovely and they got her name correct. She commented "you even remembered the hyphen."!
Have you purchased this product?

Tags

Compact Mirror
purplelavenderlilaclilacsdamaskflowerflowersfloralpersonalizedname
All Products
purplelavenderlilaclilacsdamaskflowerflowersfloralpersonalizedname

Other Info

Product ID: 256760420358941087
Created on: 2/6/2015, 10:55 AM
Rating: G